Lineage for d1pvia_ (1pvi A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487731Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 487732Superfamily c.52.1: Restriction endonuclease-like [52980] (23 families) (S)
  5. 487827Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 487828Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 487829Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 487847Domain d1pvia_: 1pvi A: [33310]

Details for d1pvia_

PDB Entry: 1pvi (more details), 2.8 Å

PDB Description: structure of pvuii endonuclease with cognate dna

SCOP Domain Sequences for d1pvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOP Domain Coordinates for d1pvia_:

Click to download the PDB-style file with coordinates for d1pvia_.
(The format of our PDB-style files is described here.)

Timeline for d1pvia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pvib_