| Class b: All beta proteins [48724] (177 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (13 species) not a true protein |
| Species Neisseria gonorrhoeae [TaxId:521006] [333087] (1 PDB entry) |
| Domain d5veva3: 5vev A:326-423 [333088] Other proteins in same PDB: d5veva1, d5veva2, d5veva4, d5vevb1, d5vevb2, d5vevb4 automated match to d1gsoa1 complexed with act, edo, na, so4 |
PDB Entry: 5vev (more details), 1.9 Å
SCOPe Domain Sequences for d5veva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5veva3 b.84.2.0 (A:326-423) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
pqtavgvvlaaqnypetpkkgdvisglddvnrigkvfhagttvnekgdvltnggrilcvv
glgddvaqakakaygalekisfdgmqyrkdiadkainr
Timeline for d5veva3:
View in 3DDomains from other chains: (mouse over for more information) d5vevb1, d5vevb2, d5vevb3, d5vevb4 |