SCOPe 2.04: Domain d1f0oa_: 1f0o A:

Lineage for d1f0oa_ (1f0o A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
   automatically mapped to Pfam PF09225

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)

8. Domain d1f0oa_: 1f0o A: [33308]
   protein/DNA complex; complexed with ca

Details for d1f0oa_

PDB Entry: 1f0o, 2.5 Å

PDB Description: pvuii endonuclease/cognate dna complex (glutaraldehyde-crosslinked crystal) at ph 7.5 with two calcium ions at each active site

PDB Compounds: (A:) type II restriction enzyme pvuii

SCOPe Domain Sequences for d1f0oa_:

Sequence, based on SEQRES records:

>d1f0oa_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Sequence, based on observed residues (ATOM records):

>d1f0oa_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpegndavdna
gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
ydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1f0oa_:

• d1f0oa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f0oa_ appears in SCOPe 2.03
  
• d1f0oa_ appears in SCOPe 2.05
  
• d1f0oa_ appears in the current release, SCOPe 2.08