Lineage for d1f0oa_ (1f0o A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245698Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 245699Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families) (S)
  5. 245786Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 245787Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 245788Species Proteus vulgaris [TaxId:585] [52998] (7 PDB entries)
  8. 245802Domain d1f0oa_: 1f0o A: [33308]

Details for d1f0oa_

PDB Entry: 1f0o (more details), 2.5 Å

PDB Description: pvuii endonuclease/cognate dna complex (glutaraldehyde-crosslinked crystal) at ph 7.5 with two calcium ions at each active site

SCOP Domain Sequences for d1f0oa_:

Sequence, based on SEQRES records: (download)

>d1f0oa_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Sequence, based on observed residues (ATOM records): (download)

>d1f0oa_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpegndavdna
gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
ydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOP Domain Coordinates for d1f0oa_:

Click to download the PDB-style file with coordinates for d1f0oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f0oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f0ob_