SCOPe 2.08: Domain d1pvub_: 1pvu B:

Lineage for d1pvub_ (1pvu B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
   automatically mapped to Pfam PF09225

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)

8. Domain d1pvub_: 1pvu B: [33307]

Details for d1pvub_

PDB Entry: 1pvu, 2.4 Å

PDB Description: the crystal structure of pvuii endonuclease reveals extensive structural homologies to ecorv

PDB Compounds: (B:) Pvu II

SCOPe Domain Sequences for d1pvub_:

Sequence, based on SEQRES records:

>d1pvub_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Sequence, based on observed residues (ATOM records):

>d1pvub_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdna
gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
ydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1pvub_:

• d1pvub_ first appeared (with stable ids) in SCOP 1.55
  
• d1pvub_ appears in SCOPe 2.07