![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins) automatically mapped to Pfam PF09225 |
![]() | Protein Restriction endonuclease PvuII [52997] (1 species) |
![]() | Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries) |
![]() | Domain d1pvub_: 1pvu B: [33307] |
PDB Entry: 1pvu (more details), 2.4 Å
SCOPe Domain Sequences for d1pvub_:
Sequence, based on SEQRES records: (download)
>d1pvub_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]} shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
>d1pvub_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]} shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdna gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy ydkwerkwysdghkdinnpkipvkyvmehgtkiy
Timeline for d1pvub_: