SCOP 1.57: Domain d1eyua_: 1eyu A:

Lineage for d1eyua_ (1eyu A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries)

8. Domain d1eyua_: 1eyu A: [33304]

Details for d1eyua_

PDB Entry: 1eyu, 1.78 Å

PDB Description: high resolution structure of the pvuii endonculease/cognate dna complex at ph 4.6

SCOP Domain Sequences for d1eyua_:

Sequence; same for both SEQRES and ATOM records:

>d1eyua_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

Timeline for d1eyua_:

• d1eyua_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyua_ appears in SCOP 1.59
  
• d1eyua_ appears in the current release, SCOPe 2.08