Lineage for d1eyua_ (1eyu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882368Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
    automatically mapped to Pfam PF09225
  6. 2882369Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 2882370Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 2882375Domain d1eyua_: 1eyu A: [33304]
    protein/DNA complex

Details for d1eyua_

PDB Entry: 1eyu (more details), 1.78 Å

PDB Description: high resolution structure of the pvuii endonculease/cognate dna complex at ph 4.6
PDB Compounds: (A:) type II restriction enzyme pvuii

SCOPe Domain Sequences for d1eyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyua_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOPe Domain Coordinates for d1eyua_:

Click to download the PDB-style file with coordinates for d1eyua_.
(The format of our PDB-style files is described here.)

Timeline for d1eyua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eyub_