Lineage for d3pvib_ (3pvi B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 585976Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 585977Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 585978Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 585980Domain d3pvib_: 3pvi B: [33301]
    protein/DNA complex; mutant

Details for d3pvib_

PDB Entry: 3pvi (more details), 1.59 Å

PDB Description: d34g mutant of pvuii endonuclease complexed with cognate dna shows that asp34 is directly involved in dna recognition and indirectly involved in catalysis

SCOP Domain Sequences for d3pvib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvib_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqgnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOP Domain Coordinates for d3pvib_:

Click to download the PDB-style file with coordinates for d3pvib_.
(The format of our PDB-style files is described here.)

Timeline for d3pvib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3pvia_