Lineage for d1dmua_ (1dmu A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371735Family c.52.1.4: Restriction endonuclease BglI [52990] (1 protein)
  6. 1371736Protein Restriction endonuclease BglI [52991] (1 species)
  7. 1371737Species Bacillus subtilis [TaxId:1423] [52992] (1 PDB entry)
  8. 1371738Domain d1dmua_: 1dmu A: [33294]
    protein/DNA complex; complexed with bme, ca

Details for d1dmua_

PDB Entry: 1dmu (more details), 2.2 Å

PDB Description: crystal structure of the restriction endonuclease bgli (e.c.3.1.21.4) bound to its dna recognition sequence
PDB Compounds: (A:) bgli restriction endonuclease

SCOPe Domain Sequences for d1dmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmua_ c.52.1.4 (A:) Restriction endonuclease BglI {Bacillus subtilis [TaxId: 1423]}
mynlhrekifmsynqnkqylednpeiqekielyglnllnevisdneeeiradyneanflh
pfwmnyppldrgkmpkgdqipwievgekavgskltrlvsqreditvreiglptgpderyl
ltsptiysltngftdsimmfvdiksvgprdsdydlvlspnqvsgngdwaqleggiqnnqq
tiqgprssqiflptipplyilsdgtiapvvhlfikpiyamrsltkgdtgqslykiklasv
pnglglfcnpgyafdsaykflfrpgkddrtksllqkrvrvdlrvldkigprvmtidmdk

SCOPe Domain Coordinates for d1dmua_:

Click to download the PDB-style file with coordinates for d1dmua_.
(The format of our PDB-style files is described here.)

Timeline for d1dmua_: