PDB entry 1dmu

View 1dmu on RCSB PDB site
Description: crystal structure of the restriction endonuclease bgli (e.c.3.1.21.4) bound to its DNA recognition sequence
Class: hydrolase/DNA
Keywords: protein-DNA complex, active site calcium ions, alpha/beta structure, a:a mismatch, hydrolase/DNA complex
Deposited on 1999-12-15, released 1999-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bgli restriction endonuclease
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dmua_
  • Chain 'F':
    Compound: DNA (5'-d(*ap*tp*cp*gp*cp*cp*tp*ap*ap*tp*ap*gp*gp*cp*gp*ap*t)-3')
    Species: synthetic, synthetic
  • Heterogens: CA, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dmuA (A:)
    mynlhrekifmsynqnkqylednpeiqekielyglnllnevisdneeeiradyneanflh
    pfwmnyppldrgkmpkgdqipwievgekavgskltrlvsqreditvreiglptgpderyl
    ltsptiysltngftdsimmfvdiksvgprdsdydlvlspnqvsgngdwaqleggiqnnqq
    tiqgprssqiflptipplyilsdgtiapvvhlfikpiyamrsltkgdtgqslykiklasv
    pnglglfcnpgyafdsaykflfrpgkddrtksllqkrvrvdlrvldkigprvmtidmdk
    

  • Chain 'F':
    No sequence available.