Lineage for d2bama_ (2bam A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490240Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)
    automatically mapped to Pfam PF02923
  6. 2490241Protein Restriction endonuclease BamHI [52988] (1 species)
  7. 2490242Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)
  8. 2490248Domain d2bama_: 2bam A: [33292]
    protein/DNA complex; complexed with ca

Details for d2bama_

PDB Entry: 2bam (more details), 2 Å

PDB Description: restriction endonuclease bamhi complex with dna and calcium ions (pre-reactive complex).
PDB Compounds: (A:) protein (endonuclease bamhi)

SCOPe Domain Sequences for d2bama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bama_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens [TaxId: 1390]}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwk

SCOPe Domain Coordinates for d2bama_:

Click to download the PDB-style file with coordinates for d2bama_.
(The format of our PDB-style files is described here.)

Timeline for d2bama_: