Lineage for d1bhmb_ (1bhm B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136306Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)
    automatically mapped to Pfam PF02923
  6. 2136307Protein Restriction endonuclease BamHI [52988] (1 species)
  7. 2136308Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)
  8. 2136317Domain d1bhmb_: 1bhm B: [33291]
    protein/DNA complex

Details for d1bhmb_

PDB Entry: 1bhm (more details), 2.2 Å

PDB Description: restriction endonuclease bamhi complex with dna
PDB Compounds: (B:) protein (bamhi (e.c.3.1.21.4))

SCOPe Domain Sequences for d1bhmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhmb_ c.52.1.3 (B:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens [TaxId: 1390]}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwkd

SCOPe Domain Coordinates for d1bhmb_:

Click to download the PDB-style file with coordinates for d1bhmb_.
(The format of our PDB-style files is described here.)

Timeline for d1bhmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bhma_