SCOPe 2.07: Domain d5j4ua2: 5j4u A:85-220

Lineage for d5j4ua2 (5j4u A:85-220)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (9 PDB entries)

8. Domain d5j4ua2: 5j4u A:85-220 [332907]
   Other proteins in same PDB: d5j4ua1
   automated match to d5agya2
   complexed with gsh

Details for d5j4ua2

PDB Entry: 5j4u, 1.25 Å

PDB Description: crystal structure of a glutathione s-transferase ptgstu30 from populus trichocarpa in complex with gsh

PDB Compounds: (A:) Glutathione transferase family protein

SCOPe Domain Sequences for d5j4ua2:

Sequence; same for both SEQRES and ATOM records:

>d5j4ua2 a.45.1.0 (A:85-220) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
llpsdpyqraqsrfwadfvdkkiydlgrkiwtkkgeeqeaakkdfidslklmegelgdkp
yfggetigyvdialvpfyswfyayetignfnieaecpkmiayckrclqketvskaledpq
kvydfvlmlmkkfgie

Timeline for d5j4ua2:

• d5j4ua2 first appeared in SCOPe 2.06
  
• d5j4ua2 appears in the current release, SCOPe 2.08