Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (9 PDB entries) |
Domain d5j4ua2: 5j4u A:85-220 [332907] Other proteins in same PDB: d5j4ua1 automated match to d5agya2 complexed with gsh |
PDB Entry: 5j4u (more details), 1.25 Å
SCOPe Domain Sequences for d5j4ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j4ua2 a.45.1.0 (A:85-220) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]} llpsdpyqraqsrfwadfvdkkiydlgrkiwtkkgeeqeaakkdfidslklmegelgdkp yfggetigyvdialvpfyswfyayetignfnieaecpkmiayckrclqketvskaledpq kvydfvlmlmkkfgie
Timeline for d5j4ua2: