Lineage for d1bhma_ (1bhm A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604276Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)
    automatically mapped to Pfam PF02923
  6. 1604277Protein Restriction endonuclease BamHI [52988] (1 species)
  7. 1604278Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)
  8. 1604286Domain d1bhma_: 1bhm A: [33290]
    protein/DNA complex

Details for d1bhma_

PDB Entry: 1bhm (more details), 2.2 Å

PDB Description: restriction endonuclease bamhi complex with dna
PDB Compounds: (A:) protein (bamhi (e.c.3.1.21.4))

SCOPe Domain Sequences for d1bhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhma_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens [TaxId: 1390]}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgm

SCOPe Domain Coordinates for d1bhma_:

Click to download the PDB-style file with coordinates for d1bhma_.
(The format of our PDB-style files is described here.)

Timeline for d1bhma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bhmb_