Lineage for d1esga_ (1esg A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123984Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 123985Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families) (S)
  5. 124048Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)
  6. 124049Protein Restriction endonuclease BamHI [52988] (1 species)
  7. 124050Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)
  8. 124052Domain d1esga_: 1esg A: [33286]

Details for d1esga_

PDB Entry: 1esg (more details), 1.9 Å

PDB Description: restriction endonuclease bamhi bound to a non-specific dna.

SCOP Domain Sequences for d1esga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esga_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwkdk

SCOP Domain Coordinates for d1esga_:

Click to download the PDB-style file with coordinates for d1esga_.
(The format of our PDB-style files is described here.)

Timeline for d1esga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1esgb_