Lineage for d5vazb_ (5vaz B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248687Fold e.13: DNA primase core [56730] (1 superfamily)
    2 domains: (1) alpha+beta; (2) toprim alpha/beta
  4. 2248688Superfamily e.13.1: DNA primase core [56731] (3 families) (S)
  5. 2248715Family e.13.1.0: automated matches [332802] (1 protein)
    not a true family
  6. 2248716Protein automated matches [332803] (1 species)
    not a true protein
  7. 2248717Species Pseudomonas aeruginosa [TaxId:208964] [332804] (1 PDB entry)
  8. 2248719Domain d5vazb_: 5vaz B: [332847]
    automated match to d1eqnc_
    complexed with so4

Details for d5vazb_

PDB Entry: 5vaz (more details), 2.4 Å

PDB Description: crystal structure of a dna primase domain from pseudomonas aeruginosa
PDB Compounds: (B:) DNA primase

SCOPe Domain Sequences for d5vazb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vazb_ e.13.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
plypllsaaaefykqalkshparkaavnylkgrgltgeiardfglgfappgwdnllkhlg
gdnlqlkamldagllvensdtgkrydrfrdrvmfpirdsrgriiafggrvlgddkpkyln
spetpvfhkgqelyglyearqknrdldeimvvegymdvialaqqgirnavatlgtatsee
hikrlfrlvpsilfcfdgdqagrkaawralesvlpnlqdgkrvrflflpegedpdslvra
egedafraritqqaqplaeyffqqlmleadpatlegkahlatlaapllekipgnnlrllm
rqrlseitglsgenigqlahh

SCOPe Domain Coordinates for d5vazb_:

Click to download the PDB-style file with coordinates for d5vazb_.
(The format of our PDB-style files is described here.)

Timeline for d5vazb_: