Lineage for d5ukka1 (5ukk A:30-185)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719852Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2719853Protein automated matches [190464] (3 species)
    not a true protein
  7. 2719862Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2719896Domain d5ukka1: 5ukk A:30-185 [332834]
    Other proteins in same PDB: d5ukka2, d5ukka3, d5ukkb_, d5ukkg_
    automated match to d3v5wa1
    complexed with 8dj, mg

Details for d5ukka1

PDB Entry: 5ukk (more details), 2.6 Å

PDB Description: human grk2 in complex with human g-beta-gamma subunits and ccg211998 (14ak)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukka1:

Sequence, based on SEQRES records: (download)

>d5ukka1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Sequence, based on observed residues (ATOM records): (download)

>d5ukka1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimfsksatehvqghlgkkqvppdlfqpyieeicqnlr
gdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d5ukka1:

Click to download the PDB-style file with coordinates for d5ukka1.
(The format of our PDB-style files is described here.)

Timeline for d5ukka1: