SCOP 1.63: Domain d4rveb_: 4rve B:

Lineage for d4rveb_ (4rve B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families)

5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)

6. Protein Restriction endonuclease EcoRV [52985] (1 species)

7. Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)

8. Domain d4rveb_: 4rve B: [33281]

Details for d4rveb_

PDB Entry: 4rve, 3 Å

PDB Description: the crystal structure of ecorv endonuclease and of its complexes with cognate and non-cognate dna segments

SCOP Domain Sequences for d4rveb_:

Sequence; same for both SEQRES and ATOM records:

>d4rveb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy

Timeline for d4rveb_:

• d4rveb_ first appeared (with stable ids) in SCOP 1.55
  
• d4rveb_ appears in SCOP 1.61
  
• d4rveb_ appears in SCOP 1.65
  
• d4rveb_ appears in the current release, SCOPe 2.08