Lineage for d4rvea_ (4rve A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316351Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 316352Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) (S)
  5. 316365Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 316366Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 316367Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)
  8. 316412Domain d4rvea_: 4rve A: [33280]

Details for d4rvea_

PDB Entry: 4rve (more details), 3 Å

PDB Description: the crystal structure of ecorv endonuclease and of its complexes with cognate and non-cognate dna segments

SCOP Domain Sequences for d4rvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rvea_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy

SCOP Domain Coordinates for d4rvea_:

Click to download the PDB-style file with coordinates for d4rvea_.
(The format of our PDB-style files is described here.)

Timeline for d4rvea_: