SCOPe 2.06: Domain d5thcf_: 5thc F:

Lineage for d5thcf_ (5thc F:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)

8. Domain d5thcf_: 5thc F: [332754]
   Other proteins in same PDB: d5thca_, d5thcc_, d5thce_
   automated match to d3m5jb_
   complexed with bma, gal, man, nag, sia; mutant

Details for d5thcf_

PDB Entry: 5thc, 2.79 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-slnln

PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thcf_:

Sequence, based on SEQRES records:

>d5thcf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records):

>d5thcf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtqaadykstqaaidqitgklnrlvekntef
esiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervr
kqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d5thcf_:

• d5thcf_ is new in SCOPe 2.06-stable
  
• d5thcf_ appears in SCOPe 2.07
  
• d5thcf_ appears in the current release, SCOPe 2.08