SCOPe 2.05: Domain d1eoob_: 1eoo B:

Lineage for d1eoob_ (1eoo B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
   automatically mapped to Pfam PF09233

6. Protein Restriction endonuclease EcoRV [52985] (1 species)

7. Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)

8. Domain d1eoob_: 1eoo B: [33271]
   protein/DNA complex

Details for d1eoob_

PDB Entry: 1eoo, 2.16 Å

PDB Description: ecorv bound to cognate dna

PDB Compounds: (B:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1eoob_:

Sequence; same for both SEQRES and ATOM records:

>d1eoob_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Timeline for d1eoob_:

• d1eoob_ first appeared (with stable ids) in SCOP 1.55
  
• d1eoob_ appears in SCOPe 2.04
  
• d1eoob_ appears in SCOPe 2.06
  
• d1eoob_ appears in the current release, SCOPe 2.08