Lineage for d1eooa_ (1eoo A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856522Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 1856523Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 1856524Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 1856569Domain d1eooa_: 1eoo A: [33270]
    protein/DNA complex

Details for d1eooa_

PDB Entry: 1eoo (more details), 2.16 Å

PDB Description: ecorv bound to cognate dna
PDB Compounds: (A:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1eooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eooa_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1eooa_:

Click to download the PDB-style file with coordinates for d1eooa_.
(The format of our PDB-style files is described here.)

Timeline for d1eooa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eoob_