Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
Protein automated matches [190431] (12 species) not a true protein |
Species Solanum habrochaites [TaxId:62890] [332525] (5 PDB entries) |
Domain d5hxpa_: 5hxp A: [332589] automated match to d4h8ea_ complexed with ipr, mg, o4b; mutant |
PDB Entry: 5hxp (more details), 1.95 Å
SCOPe Domain Sequences for d5hxpa_:
Sequence, based on SEQRES records: (download)
>d5hxpa_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]} ldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafs tenwkrakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnk glhlvialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtg gdqrvsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfggh
>d5hxpa_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]} ldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafs tenevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnkglhlvi alnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtggdqrvs nfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfggh
Timeline for d5hxpa_: