Lineage for d5hxpa_ (5hxp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526295Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2526296Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2526364Family c.101.1.0: automated matches [191361] (1 protein)
    not a true family
  6. 2526365Protein automated matches [190431] (12 species)
    not a true protein
  7. 2526422Species Solanum habrochaites [TaxId:62890] [332525] (5 PDB entries)
  8. 2526425Domain d5hxpa_: 5hxp A: [332589]
    automated match to d4h8ea_
    complexed with ipr, mg, o4b; mutant

Details for d5hxpa_

PDB Entry: 5hxp (more details), 1.95 Å

PDB Description: crystal structure of z,z-farnesyl diphosphate synthase (d71m, e75a and h103y mutants) complexed with ipp
PDB Compounds: (A:) (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic

SCOPe Domain Sequences for d5hxpa_:

Sequence, based on SEQRES records: (download)

>d5hxpa_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]}
ldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafs
tenwkrakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnk
glhlvialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtg
gdqrvsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfggh

Sequence, based on observed residues (ATOM records): (download)

>d5hxpa_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]}
ldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafs
tenevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnkglhlvi
alnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtggdqrvs
nfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfggh

SCOPe Domain Coordinates for d5hxpa_:

Click to download the PDB-style file with coordinates for d5hxpa_.
(The format of our PDB-style files is described here.)

Timeline for d5hxpa_: