Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (8 PDB entries) |
Domain d5f0ga2: 5f0g A:85-212 [332533] Other proteins in same PDB: d5f0ga1, d5f0gb1 automated match to d3vk9c2 complexed with k, na |
PDB Entry: 5f0g (more details), 1.6 Å
SCOPe Domain Sequences for d5f0ga2:
Sequence, based on SEQRES records: (download)
>d5f0ga2 a.45.1.0 (A:85-212) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ndpkkravinqrlyfdmgtlyesfakyyyplfrtgkpgsdedlkrietafgfldtflegq eyvagdqltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamk alfdarkl
>d5f0ga2 a.45.1.0 (A:85-212) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ndpkkravinqrlyfdmgtlyesfakyyyplpgsdedlkrietafgfldtflegqeyvag dqltvadiailstvstfevsefdfskysnvsrwydnakkvtpgwdenweglmamkalfda rkl
Timeline for d5f0ga2: