SCOP 1.63: Domain d1b97a_: 1b97 A:

Lineage for d1b97a_ (1b97 A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families)

5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)

6. Protein Restriction endonuclease EcoRV [52985] (1 species)

7. Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)

8. Domain d1b97a_: 1b97 A: [33252]

Details for d1b97a_

PDB Entry: 1b97, 1.9 Å

PDB Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group

SCOP Domain Sequences for d1b97a_:

Sequence; same for both SEQRES and ATOM records:

>d1b97a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqlnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Timeline for d1b97a_:

• d1b97a_ first appeared (with stable ids) in SCOP 1.55
  
• d1b97a_ appears in SCOP 1.61
  
• d1b97a_ appears in SCOP 1.65
  
• d1b97a_ appears in the current release, SCOPe 2.08