Lineage for d1rvba_ (1rvb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604212Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 1604213Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 1604214Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 1604225Domain d1rvba_: 1rvb A: [33244]
    protein/DNA complex; complexed with mg

Details for d1rvba_

PDB Entry: 1rvb (more details), 2.1 Å

PDB Description: mg2+ binding to the active site of eco rv endonuclease: a crystallographic study of complexes with substrate and product dna at 2 angstroms resolution
PDB Compounds: (A:) protein (eco rv (e.c.3.1.21.4))

SCOPe Domain Sequences for d1rvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvba_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1rvba_:

Click to download the PDB-style file with coordinates for d1rvba_.
(The format of our PDB-style files is described here.)

Timeline for d1rvba_: