![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
![]() | Domain d5nevb2: 5nev B:310-429 [332437] Other proteins in same PDB: d5neva1, d5neva2, d5nevc1, d5nevc2 automated match to d1oi9b2 complexed with 72l |
PDB Entry: 5nev (more details), 2.97 Å
SCOPe Domain Sequences for d5nevb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nevb2 a.74.1.1 (B:310-429) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
Timeline for d5nevb2: