SCOP 1.61: Domain d1rvcb_: 1rvc B:

Lineage for d1rvcb_ (1rvc B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families)

5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)

6. Protein Restriction endonuclease EcoRV [52985] (1 species)

7. Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)

8. Domain d1rvcb_: 1rvc B: [33243]

Details for d1rvcb_

PDB Entry: 1rvc, 2.1 Å

PDB Description: mg2+ binding to the active site of eco rv endonuclease: a crystallographic study of complexes with substrate and product dna at 2 angstroms resolution

SCOP Domain Sequences for d1rvcb_:

Sequence; same for both SEQRES and ATOM records:

>d1rvcb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Timeline for d1rvcb_:

• d1rvcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvcb_ appears in SCOP 1.59
  
• d1rvcb_ appears in SCOP 1.63
  
• d1rvcb_ appears in the current release, SCOPe 2.08