Lineage for d1rvaa_ (1rva A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136242Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2136243Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2136244Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2136251Domain d1rvaa_: 1rva A: [33240]
    protein/DNA complex

Details for d1rvaa_

PDB Entry: 1rva (more details), 2 Å

PDB Description: mg2+ binding to the active site of eco rv endonuclease: a crystallographic study of complexes with substrate and product dna at 2 angstroms resolution
PDB Compounds: (A:) protein (eco rv (e.c.3.1.21.4))

SCOPe Domain Sequences for d1rvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvaa_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1rvaa_:

Click to download the PDB-style file with coordinates for d1rvaa_.
(The format of our PDB-style files is described here.)

Timeline for d1rvaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rvab_