SCOPe 2.06: Domain d5usja1: 5usj A:1-168

Lineage for d5usja1 (5usj A:1-168)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d5usja1: 5usj A:1-168 [332310]
   Other proteins in same PDB: d5usja2, d5usjb2, d5usjc2, d5usjd2, d5usje2, d5usjf2
   automated match to d4obea_
   complexed with gnp, mg; mutant

Details for d5usja1

PDB Entry: 5usj, 1.94 Å

PDB Description: crystal structure of human kras g12d mutant in complex with gdpnp

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5usja1:

Sequence, based on SEQRES records:

>d5usja1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Sequence, based on observed residues (ATOM records):

>d5usja1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
ysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsr
tvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d5usja1:

• d5usja1 is new in SCOPe 2.06-stable
  
• d5usja1 appears in SCOPe 2.07
  
• d5usja1 appears in the current release, SCOPe 2.08