Lineage for d5usja1 (5usj A:1-168)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125340Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)
  8. 2125535Domain d5usja1: 5usj A:1-168 [332310]
    Other proteins in same PDB: d5usja2, d5usjb2, d5usjc2, d5usjd2, d5usje2, d5usjf2
    automated match to d4obea_
    complexed with gnp, mg; mutant

Details for d5usja1

PDB Entry: 5usj (more details), 1.94 Å

PDB Description: crystal structure of human kras g12d mutant in complex with gdpnp
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5usja1:

Sequence, based on SEQRES records: (download)

>d5usja1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Sequence, based on observed residues (ATOM records): (download)

>d5usja1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
ysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsr
tvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

SCOPe Domain Coordinates for d5usja1:

Click to download the PDB-style file with coordinates for d5usja1.
(The format of our PDB-style files is described here.)

Timeline for d5usja1: