Lineage for d1eria_ (1eri A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604197Family c.52.1.1: Restriction endonuclease EcoRI [52981] (2 proteins)
    automatically mapped to Pfam PF02963
  6. 1604198Protein Restriction endonuclease EcoRI [52982] (1 species)
  7. 1604199Species Escherichia coli [TaxId:562] [52983] (7 PDB entries)
  8. 1604203Domain d1eria_: 1eri A: [33231]
    protein/DNA complex

Details for d1eria_

PDB Entry: 1eri (more details), 2.5 Å

PDB Description: x-ray structure of the dna-eco ri endonuclease-dna recognition complex: the recognition network and the integration of recognition and cleavage
PDB Compounds: (A:) protein (eco ri endonuclease (e.c.3.1.21.4))

SCOPe Domain Sequences for d1eria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eria_ c.52.1.1 (A:) Restriction endonuclease EcoRI {Escherichia coli [TaxId: 562]}
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
maagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

SCOPe Domain Coordinates for d1eria_:

Click to download the PDB-style file with coordinates for d1eria_.
(The format of our PDB-style files is described here.)

Timeline for d1eria_: