SCOPe 2.08: Domain d5uzmb_: 5uzm B:

Lineage for d5uzmb_ (5uzm B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [332223] (3 PDB entries)

8. Domain d5uzmb_: 5uzm B: [332224]
   automated match to d2kfya_

Details for d5uzmb_

PDB Entry: 5uzm, 1.55 Å

PDB Description: crystal structure of glorund qrrm2 domain

PDB Compounds: (B:) AT27789p

SCOPe Domain Sequences for d5uzmb_:

Sequence; same for both SEQRES and ATOM records:

>d5uzmb_ d.58.7.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tafvvklrglpyavteqqieeffsgldiktdregilfvmdrrgratgeafvqfesqddte
qalgrnrekighryieifrssiaemkrat

Timeline for d5uzmb_:

• d5uzmb_ first appeared in SCOPe 2.06
  
• d5uzmb_ appears in SCOPe 2.07