Lineage for d1b76a1 (1b76 A:395-505)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181602Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 181603Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 181604Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 181619Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species)
  7. 181620Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries)
  8. 181623Domain d1b76a1: 1b76 A:395-505 [33198]
    Other proteins in same PDB: d1b76a2, d1b76b2

Details for d1b76a1

PDB Entry: 1b76 (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with atp

SCOP Domain Sequences for d1b76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b76a1 c.51.1.1 (A:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw

SCOP Domain Coordinates for d1b76a1:

Click to download the PDB-style file with coordinates for d1b76a1.
(The format of our PDB-style files is described here.)

Timeline for d1b76a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b76a2