| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
| Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species) |
| Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries) |
| Domain d1atib1: 1ati B:395-505 [33197] Other proteins in same PDB: d1atia2, d1atib2 |
PDB Entry: 1ati (more details), 2.75 Å
SCOP Domain Sequences for d1atib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atib1 c.51.1.1 (B:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw
Timeline for d1atib1: