Lineage for d1adyb1 (1ady B:326-421)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700602Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 700603Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) (S)
  5. 700604Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 700613Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 700633Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)
  8. 700640Domain d1adyb1: 1ady B:326-421 [33193]
    Other proteins in same PDB: d1adya2, d1adyb2, d1adyc2, d1adyd2

Details for d1adyb1

PDB Entry: 1ady (more details), 2.8 Å

PDB Description: histidyl-trna synthetase in complex with histidyl-adenylate
PDB Compounds: (B:) histidyl-tRNA synthetase

SCOP Domain Sequences for d1adyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adyb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

SCOP Domain Coordinates for d1adyb1:

Click to download the PDB-style file with coordinates for d1adyb1.
(The format of our PDB-style files is described here.)

Timeline for d1adyb1: