Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins) |
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) |
Species Thermus thermophilus [TaxId:274] [52959] (2 PDB entries) |
Domain d1adyb1: 1ady B:326-421 [33193] Other proteins in same PDB: d1adya2, d1adyb2, d1adyc2, d1adyd2 |
PDB Entry: 1ady (more details), 2.8 Å
SCOP Domain Sequences for d1adyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adyb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus} ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg edelragevtlkrlatgeqvrlsreevpgyllqalg
Timeline for d1adyb1: