SCOP 1.61: Domain d1adjd1: 1adj D:326-421

Lineage for d1adjd1 (1adj D:326-421)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)

7. Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)

8. Domain d1adjd1: 1adj D:326-421 [33191]
   Other proteins in same PDB: d1adja2, d1adjb2, d1adjc2, d1adjd2

Details for d1adjd1

PDB Entry: 1adj, 2.7 Å

PDB Description: histidyl-trna synthetase in complex with histidine

SCOP Domain Sequences for d1adjd1:

Sequence; same for both SEQRES and ATOM records:

>d1adjd1 c.51.1.1 (D:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

Timeline for d1adjd1:

• d1adjd1 first appeared (with stable ids) in SCOP 1.55
  
• d1adjd1 appears in SCOP 1.59
  
• d1adjd1 appears in SCOP 1.63
  
• d1adjd1 appears in the current release, SCOPe 2.08