SCOP 1.61: Domain d1qe0b1: 1qe0 B:326-419

Lineage for d1qe0b1 (1qe0 B:326-419)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [52958] (1 PDB entry)

8. Domain d1qe0b1: 1qe0 B:326-419 [33187]
   Other proteins in same PDB: d1qe0a2, d1qe0b2

Details for d1qe0b1

PDB Entry: 1qe0, 2.7 Å

PDB Description: crystal structure of apo s. aureus histidyl-trna synthetase

SCOP Domain Sequences for d1qe0b1:

Sequence; same for both SEQRES and ATOM records:

>d1qe0b1 c.51.1.1 (B:326-419) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus}
ieenldlfivtmgdqadryavkllnhlrhngikadkdylqrkikgqmkqadrlgakftiv
igdqelennkidvknmttgesetieldalveyfk

Timeline for d1qe0b1:

• d1qe0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1qe0b1 appears in SCOP 1.59
  
• d1qe0b1 appears in SCOP 1.63
  
• d1qe0b1 appears in the current release, SCOPe 2.08