Lineage for d1kmna1 (1kmn A:326-424)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 396855Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 396856Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 396857Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 396866Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 396867Species Escherichia coli [TaxId:562] [52957] (3 PDB entries)
  8. 396876Domain d1kmna1: 1kmn A:326-424 [33182]
    Other proteins in same PDB: d1kmna2, d1kmnb2, d1kmnc2, d1kmnd2

Details for d1kmna1

PDB Entry: 1kmn (more details), 2.8 Å

PDB Description: histidyl-trna synthetase complexed with histidinol and atp

SCOP Domain Sequences for d1kmna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmna1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOP Domain Coordinates for d1kmna1:

Click to download the PDB-style file with coordinates for d1kmna1.
(The format of our PDB-style files is described here.)

Timeline for d1kmna1: