SCOPe 2.08: Domain d1kmna1: 1kmn A:326-424

Lineage for d1kmna1 (1kmn A:326-424)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)

7. Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)

8. Domain d1kmna1: 1kmn A:326-424 [33182]
   Other proteins in same PDB: d1kmna2, d1kmnb2, d1kmnc2, d1kmnd2
   protein/RNA complex; complexed with atp, hso

Details for d1kmna1

PDB Entry: 1kmn, 2.8 Å

PDB Description: histidyl-trna synthetase complexed with histidinol and atp

PDB Compounds: (A:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1kmna1:

Sequence; same for both SEQRES and ATOM records:

>d1kmna1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

Timeline for d1kmna1:

• d1kmna1 first appeared (with stable ids) in SCOP 1.55
  
• d1kmna1 appears in SCOPe 2.07