|  | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) | 
|  | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest | 
|  | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)  | 
|  | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) | 
|  | Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) | 
|  | Species Escherichia coli [TaxId:562] [52957] (3 PDB entries) | 
|  | Domain d1httb1: 1htt B:326-424 [33179] Other proteins in same PDB: d1htta2, d1httb2, d1httc2, d1httd2 | 
PDB Entry: 1htt (more details), 2.6 Å
SCOP Domain Sequences for d1httb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1httb1 c.51.1.1 (B:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg
Timeline for d1httb1: