Lineage for d1httb1 (1htt B:326-424)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316208Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 316209Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 316210Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 316219Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 316220Species Escherichia coli [TaxId:562] [52957] (3 PDB entries)
  8. 316226Domain d1httb1: 1htt B:326-424 [33179]
    Other proteins in same PDB: d1htta2, d1httb2, d1httc2, d1httd2

Details for d1httb1

PDB Entry: 1htt (more details), 2.6 Å

PDB Description: histidyl-trna synthetase

SCOP Domain Sequences for d1httb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1httb1 c.51.1.1 (B:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOP Domain Coordinates for d1httb1:

Click to download the PDB-style file with coordinates for d1httb1.
(The format of our PDB-style files is described here.)

Timeline for d1httb1: