| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
| Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) |
| Species Escherichia coli [TaxId:562] [52957] (3 PDB entries) |
| Domain d1htta1: 1htt A:326-424 [33178] Other proteins in same PDB: d1htta2, d1httb2, d1httc2, d1httd2 |
PDB Entry: 1htt (more details), 2.6 Å
SCOP Domain Sequences for d1htta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htta1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg
Timeline for d1htta1: