Lineage for d1kmmc1 (1kmm C:326-424)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1603871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 1603872Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 1603881Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 1603882Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)
  8. 1603885Domain d1kmmc1: 1kmm C:326-424 [33176]
    Other proteins in same PDB: d1kmma2, d1kmmb2, d1kmmc2, d1kmmd2
    protein/RNA complex; complexed with ham

Details for d1kmmc1

PDB Entry: 1kmm (more details), 2.6 Å

PDB Description: histidyl-trna synthetase complexed with histidyl-adenylate
PDB Compounds: (C:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1kmmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmmc1 c.51.1.1 (C:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOPe Domain Coordinates for d1kmmc1:

Click to download the PDB-style file with coordinates for d1kmmc1.
(The format of our PDB-style files is described here.)

Timeline for d1kmmc1: