Lineage for d1kmmb1 (1kmm B:326-424)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245573Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 245574Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 245575Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 245584Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 245585Species Escherichia coli [TaxId:562] [52957] (3 PDB entries)
  8. 245587Domain d1kmmb1: 1kmm B:326-424 [33175]
    Other proteins in same PDB: d1kmma2, d1kmmb2, d1kmmc2, d1kmmd2

Details for d1kmmb1

PDB Entry: 1kmm (more details), 2.6 Å

PDB Description: histidyl-trna synthetase complexed with histidyl-adenylate

SCOP Domain Sequences for d1kmmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmmb1 c.51.1.1 (B:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOP Domain Coordinates for d1kmmb1:

Click to download the PDB-style file with coordinates for d1kmmb1.
(The format of our PDB-style files is described here.)

Timeline for d1kmmb1: