Lineage for d5lkyc_ (5lky C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445223Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)
  8. 2445238Domain d5lkyc_: 5lky C: [331690]
    automated match to d4ahob_
    complexed with peg

Details for d5lkyc_

PDB Entry: 5lky (more details), 1.7 Å

PDB Description: x-ray crystal structure of n-acetylneuraminic acid lyase in complex with pyruvate, with the phenylalanine at position 190 replaced with the non-canonical amino acid dihydroxypropylcysteine.
PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5lkyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lkyc_ c.1.10.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]}
kdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkkq
vfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeirdy
yfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnffllerirkafp
dklilsgxdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndi
ietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d5lkyc_:

Click to download the PDB-style file with coordinates for d5lkyc_.
(The format of our PDB-style files is described here.)

Timeline for d5lkyc_: