Lineage for d5jsya_ (5jsy A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624629Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2624664Protein automated matches [190110] (7 species)
    not a true protein
  7. 2624744Species Desulfovibrio vulgaris [TaxId:882] [197352] (21 PDB entries)
  8. 2624749Domain d5jsya_: 5jsy A: [331671]
    automated match to d3ze9a_
    complexed with cl, fco, fe2, h2s, ni, sf4

Details for d5jsya_

PDB Entry: 5jsy (more details), 1.04 Å

PDB Description: the 3d structure of the ni-reconstituted u489c variant of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough at 1.04 angstrom resolution
PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d5jsya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jsya_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gtltgerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaieh
mrkvaekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgt
caayggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkn
glegglaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckg
pmtmadcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d5jsya_:

Click to download the PDB-style file with coordinates for d5jsya_.
(The format of our PDB-style files is described here.)

Timeline for d5jsya_: