SCOPe 2.07: Domain d5ws6l_: 5ws6 l:

Lineage for d5ws6l_ (5ws6 l:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)

8. Domain d5ws6l_: 5ws6 l: [331591]
   Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
   automated match to d2axtl1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6l_

PDB Entry: 5ws6, 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset

PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5ws6l_:

Sequence; same for both SEQRES and ATOM records:

>d5ws6l_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
epnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d5ws6l_:

• d5ws6l_ first appeared in SCOPe 2.06
  
• d5ws6l_ appears in the current release, SCOPe 2.08