Lineage for d1e0ud3 (1e0u D:354-470)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603561Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1603562Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1603563Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1603564Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1603572Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 1603584Domain d1e0ud3: 1e0u D:354-470 [33157]
    Other proteins in same PDB: d1e0ua1, d1e0ua2, d1e0ub1, d1e0ub2, d1e0uc1, d1e0uc2, d1e0ud1, d1e0ud2
    complexed with so4; mutant

Details for d1e0ud3

PDB Entry: 1e0u (more details), 2.8 Å

PDB Description: structure r271l mutant of e. coli pyruvate kinase
PDB Compounds: (D:) pyruvate kinase

SCOPe Domain Sequences for d1e0ud3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ud3 c.49.1.1 (D:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]}
iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk
gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOPe Domain Coordinates for d1e0ud3:

Click to download the PDB-style file with coordinates for d1e0ud3.
(The format of our PDB-style files is described here.)

Timeline for d1e0ud3: