Lineage for d5uaxe1 (5uax E:1-164)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107789Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2107837Domain d5uaxe1: 5uax E:1-164 [331447]
    Other proteins in same PDB: d5uaxa2, d5uaxa3, d5uaxb2, d5uaxb3, d5uaxc2, d5uaxc3, d5uaxd2, d5uaxd3, d5uaxe2
    automated match to d2izza1
    complexed with cl

Details for d5uaxe1

PDB Entry: 5uax (more details), 1.85 Å

PDB Description: structure of apo human pycr-1 crystallized in space group c2
PDB Compounds: (E:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uaxe1:

Sequence, based on SEQRES records: (download)

>d5uaxe1 c.2.1.0 (E:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

Sequence, based on observed residues (ATOM records): (download)

>d5uaxe1 c.2.1.0 (E:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimassvkltphnketvqhsdvlflavkphii
pfildeigadiedrhivvscaagvtissiekklsafrpaprvircmtntpvvvregatvy
atgthaqvedgrlmeqllssvgfctevee

SCOPe Domain Coordinates for d5uaxe1:

Click to download the PDB-style file with coordinates for d5uaxe1.
(The format of our PDB-style files is described here.)

Timeline for d5uaxe1: